Lineage for d1qlba2 (1qlb A:1-250,A:372-457)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2096453Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2096454Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2096891Family c.3.1.4: Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain [51934] (5 protein domains)
  6. 2096930Protein Fumarate reductase [51937] (2 species)
  7. 2096942Species Wolinella succinogenes [TaxId:844] [51939] (6 PDB entries)
  8. 2096949Domain d1qlba2: 1qlb A:1-250,A:372-457 [30429]
    Other proteins in same PDB: d1qlba1, d1qlba3, d1qlbb1, d1qlbb2, d1qlbc_, d1qlbd1, d1qlbd3, d1qlbe1, d1qlbe2, d1qlbf_
    complexed with ca, f3s, fad, fes, fum, hem, lmt, sf4

Details for d1qlba2

PDB Entry: 1qlb (more details), 2.33 Å

PDB Description: respiratory complex II-like fumarate reductase from Wolinella succinogenes
PDB Compounds: (A:) Fumarate reductase flavoprotein subunit

SCOPe Domain Sequences for d1qlba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlba2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}
mkvqycdslviggglaglraavatqqkglstivlslipvkrshsaaaqggmqaslgnskm
sdgdnedlhfmdtvkgsdwgcdqkvarmfvntapkairelaawgvpwtrihkgdrmaiin
aqkttiteedfrhglihsrdfggtkkwrtcytadatghtmlfavaneclklgvsiqdrke
aialihqdgkcygavvrdlvtgdiiayvakgtliatggygriyknttnavvcegtgtaia
letgiaqlgnXmggirtdyrgeaklkglfsageaacwdmhgfnrlggnsvseavvagmiv
geyfaehcantqvdletktlekfvkgqeaymkslves

SCOPe Domain Coordinates for d1qlba2:

Click to download the PDB-style file with coordinates for d1qlba2.
(The format of our PDB-style files is described here.)

Timeline for d1qlba2: