![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
![]() | Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) ![]() |
![]() | Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
![]() | Protein automated matches [226970] (6 species) not a true protein |
![]() | Species Streptomyces coelicolor [311234] (1 PDB entry) |
![]() | Domain d2oflb2: 2ofl B:90-229 [304282] Other proteins in same PDB: d2ofla1, d2oflb1 automated match to d3c07a2 complexed with pg4 |
PDB Entry: 2ofl (more details), 2.9 Å
SCOPe Domain Sequences for d2oflb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oflb2 a.121.1.1 (B:90-229) automated matches {Streptomyces coelicolor} tdlearlagvlkvwldiatpyhefavqffknaadpdsplspfspeseharveaigihrav lagaktkvpeelrdilpelmwlsqmglvlywifdrtegrersyrlaergarltargvvla rfrvlrplvrevhelftdfl
Timeline for d2oflb2: