Lineage for d2oflb2 (2ofl B:90-229)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2727850Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2727851Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2727852Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2728220Protein automated matches [226970] (6 species)
    not a true protein
  7. 2728259Species Streptomyces coelicolor [311234] (1 PDB entry)
  8. 2728261Domain d2oflb2: 2ofl B:90-229 [304282]
    Other proteins in same PDB: d2ofla1, d2oflb1
    automated match to d3c07a2
    complexed with pg4

Details for d2oflb2

PDB Entry: 2ofl (more details), 2.9 Å

PDB Description: Structural Genomics, the crystal structure of a tetR-family transcriptional regulator from Streptomyces coelicolor A3(2)
PDB Compounds: (B:) Putative tetR-family transcriptional regulator

SCOPe Domain Sequences for d2oflb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oflb2 a.121.1.1 (B:90-229) automated matches {Streptomyces coelicolor}
tdlearlagvlkvwldiatpyhefavqffknaadpdsplspfspeseharveaigihrav
lagaktkvpeelrdilpelmwlsqmglvlywifdrtegrersyrlaergarltargvvla
rfrvlrplvrevhelftdfl

SCOPe Domain Coordinates for d2oflb2:

Click to download the PDB-style file with coordinates for d2oflb2.
(The format of our PDB-style files is described here.)

Timeline for d2oflb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oflb1