Lineage for d2ofla2 (2ofl A:90-235)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011555Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2011556Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2011557Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2011877Protein automated matches [226970] (7 species)
    not a true protein
  7. 2011926Species Streptomyces coelicolor [311234] (1 PDB entry)
  8. 2011927Domain d2ofla2: 2ofl A:90-235 [304280]
    Other proteins in same PDB: d2ofla1, d2oflb1
    automated match to d3c07a2
    complexed with pg4

Details for d2ofla2

PDB Entry: 2ofl (more details), 2.9 Å

PDB Description: Structural Genomics, the crystal structure of a tetR-family transcriptional regulator from Streptomyces coelicolor A3(2)
PDB Compounds: (A:) Putative tetR-family transcriptional regulator

SCOPe Domain Sequences for d2ofla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ofla2 a.121.1.1 (A:90-235) automated matches {Streptomyces coelicolor}
tdlearlagvlkvwldiatpyhefavqffknaadpdsplspfspeseharveaigihrav
lagaktkvpeelrdilpelmwlsqmglvlywifdrtegrersyrlaergarltargvvla
rfrvlrplvrevhelftdflpgmtkv

SCOPe Domain Coordinates for d2ofla2:

Click to download the PDB-style file with coordinates for d2ofla2.
(The format of our PDB-style files is described here.)

Timeline for d2ofla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ofla1