Class a: All alpha proteins [46456] (290 folds) |
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) |
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
Protein automated matches [226970] (6 species) not a true protein |
Species Streptomyces coelicolor [311234] (1 PDB entry) |
Domain d2ofla2: 2ofl A:90-235 [304280] Other proteins in same PDB: d2ofla1, d2oflb1 automated match to d3c07a2 complexed with pg4 |
PDB Entry: 2ofl (more details), 2.9 Å
SCOPe Domain Sequences for d2ofla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ofla2 a.121.1.1 (A:90-235) automated matches {Streptomyces coelicolor} tdlearlagvlkvwldiatpyhefavqffknaadpdsplspfspeseharveaigihrav lagaktkvpeelrdilpelmwlsqmglvlywifdrtegrersyrlaergarltargvvla rfrvlrplvrevhelftdflpgmtkv
Timeline for d2ofla2: