SCOPe 2.08: Domain d2ofla2: 2ofl A:90-235

Lineage for d2ofla2 (2ofl A:90-235)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein automated matches [226970] (6 species)
   not a true protein

7. Species Streptomyces coelicolor [311234] (1 PDB entry)

8. Domain d2ofla2: 2ofl A:90-235 [304280]
   Other proteins in same PDB: d2ofla1, d2oflb1
   automated match to d3c07a2
   complexed with pg4

Details for d2ofla2

PDB Entry: 2ofl, 2.9 Å

PDB Description: Structural Genomics, the crystal structure of a tetR-family transcriptional regulator from Streptomyces coelicolor A3(2)

PDB Compounds: (A:) Putative tetR-family transcriptional regulator

SCOPe Domain Sequences for d2ofla2:

Sequence; same for both SEQRES and ATOM records:

>d2ofla2 a.121.1.1 (A:90-235) automated matches {Streptomyces coelicolor}
tdlearlagvlkvwldiatpyhefavqffknaadpdsplspfspeseharveaigihrav
lagaktkvpeelrdilpelmwlsqmglvlywifdrtegrersyrlaergarltargvvla
rfrvlrplvrevhelftdflpgmtkv

Timeline for d2ofla2:

• d2ofla2 first appeared in SCOPe 2.06
  
• d2ofla2 appears in SCOPe 2.07