Lineage for d2ofla1 (2ofl A:15-89)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2306149Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2306150Protein automated matches [190674] (25 species)
    not a true protein
  7. 2306317Species Streptomyces coelicolor [311233] (1 PDB entry)
  8. 2306318Domain d2ofla1: 2ofl A:15-89 [304279]
    Other proteins in same PDB: d2ofla2, d2oflb2
    automated match to d3c07a1
    complexed with pg4

Details for d2ofla1

PDB Entry: 2ofl (more details), 2.9 Å

PDB Description: Structural Genomics, the crystal structure of a tetR-family transcriptional regulator from Streptomyces coelicolor A3(2)
PDB Compounds: (A:) Putative tetR-family transcriptional regulator

SCOPe Domain Sequences for d2ofla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ofla1 a.4.1.0 (A:15-89) automated matches {Streptomyces coelicolor}
skseqtraliletamrlfqergydrttmraiaqeagvsvgnayyyfagkehliqgfydri
aaehraavrevlare

SCOPe Domain Coordinates for d2ofla1:

Click to download the PDB-style file with coordinates for d2ofla1.
(The format of our PDB-style files is described here.)

Timeline for d2ofla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ofla2