![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
![]() | Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
![]() | Protein automated matches [190674] (25 species) not a true protein |
![]() | Species Streptomyces coelicolor [311233] (1 PDB entry) |
![]() | Domain d2ofla1: 2ofl A:15-89 [304279] Other proteins in same PDB: d2ofla2, d2oflb2 automated match to d3c07a1 complexed with pg4 |
PDB Entry: 2ofl (more details), 2.9 Å
SCOPe Domain Sequences for d2ofla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ofla1 a.4.1.0 (A:15-89) automated matches {Streptomyces coelicolor} skseqtraliletamrlfqergydrttmraiaqeagvsvgnayyyfagkehliqgfydri aaehraavrevlare
Timeline for d2ofla1: