Lineage for d2oewa_ (2oew A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726649Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. 2726989Family a.118.8.0: automated matches [191581] (1 protein)
    not a true family
  6. 2726990Protein automated matches [191037] (12 species)
    not a true protein
  7. 2727017Species Human (Homo sapiens) [TaxId:9606] [255451] (15 PDB entries)
  8. 2727030Domain d2oewa_: 2oew A: [304278]
    automated match to d1zb1a_

Details for d2oewa_

PDB Entry: 2oew (more details), 2.55 Å

PDB Description: structure of alix/aip1 bro1 domain
PDB Compounds: (A:) Programmed cell death 6-interacting protein

SCOPe Domain Sequences for d2oewa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oewa_ a.118.8.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
matfisvqlkktsevdlakplvkfiqqtypsggeeqaqycraaeelsklrraavgrpldk
hegaletllryydqicsiepkfpfsenqicltftwkdafdkgslfggsvklalaslgyek
scvlfncaalasqiaaeqnldndeglkiaakhyqfasgaflhiketvlsalsreptvdis
pdtvgtlslimlaqaqevfflkatrdkmkdaiiaklanqaadyfgdafkqcqykdtlpke
vfpvlaakhcimqanaeyhqsilakqqkkfgeeiarlqhaaeliktvasrydeyvnvkdf
sdkinralaaakkdndfiyhdrvpdlkdldpigkatlvkstpvnvpisqkftdlfekm

SCOPe Domain Coordinates for d2oewa_:

Click to download the PDB-style file with coordinates for d2oewa_.
(The format of our PDB-style files is described here.)

Timeline for d2oewa_: