Lineage for d2o9mf_ (2o9m F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2966179Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2966180Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2966888Family d.96.1.0: automated matches [227243] (1 protein)
    not a true family
  6. 2966889Protein automated matches [227009] (16 species)
    not a true protein
  7. 2966932Species Escherichia coli [311232] (2 PDB entries)
  8. 2966939Domain d2o9mf_: 2o9m F: [304269]
    automated match to d3o1kb_
    complexed with ph2

Details for d2o9mf_

PDB Entry: 2o9m (more details), 2.45 Å

PDB Description: Crystal structure of E.coli dihydroneopterin aldolase in complex with 6-hydroxymethyl-7,8-dihydropterin
PDB Compounds: (F:) dihydroneopterin aldolase

SCOPe Domain Sequences for d2o9mf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o9mf_ d.96.1.0 (F:) automated matches {Escherichia coli}
mdivfieqlsvittigvydweqtieqklvfdiemawdnrkaaksddvadclsyadiaetv
vshvegarfalvervaeevaelllarfnspwvriklskpgavaraanvgviiergnnlke

SCOPe Domain Coordinates for d2o9mf_:

Click to download the PDB-style file with coordinates for d2o9mf_.
(The format of our PDB-style files is described here.)

Timeline for d2o9mf_: