SCOPe 2.08: Domain d2o6fa_: 2o6f A:

Lineage for d2o6fa_ (2o6f A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.33: Membrane antigen precursor-like [310605] (2 families)
   Pfam PF10634

5. Family b.1.33.1: Membrane antigen precursor-like [310656] (2 proteins)

6. Protein Tp34 lipoprotein [310819] (1 species)

7. Species Treponema pallidum [TaxId:160] [311086] (4 PDB entries)

8. Domain d2o6fa_: 2o6f A: [304260]
   automated match to d2o6ca_
   complexed with cl, edo, so4

Details for d2o6fa_

PDB Entry: 2o6f, 1.63 Å

PDB Description: structure of metal- free rtp34 from treponema pallidum

PDB Compounds: (A:) 34 kDa membrane antigen

SCOPe Domain Sequences for d2o6fa_:

Sequence; same for both SEQRES and ATOM records:

>d2o6fa_ b.1.33.1 (A:) Tp34 lipoprotein {Treponema pallidum [TaxId: 160]}
defpigedrdvgplhvggvyfqpvemhpapgaqpskeeadchieadihaneagkdlgygv
gdfvpylrvvaflqkhgsekvqkvmfapmnagdgphyganvkfeeglgtykvrfeiaaps
hdeyslhideqtgvsgrfwseplvaewddfewkgpqw

Timeline for d2o6fa_:

• d2o6fa_ first appeared in SCOPe 2.06
  
• d2o6fa_ appears in SCOPe 2.07