Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.33: Membrane antigen precursor-like [310605] (2 families) Pfam PF10634 |
Family b.1.33.1: Membrane antigen precursor-like [310656] (2 proteins) |
Protein Tp34 lipoprotein [310819] (1 species) |
Species Treponema pallidum [TaxId:160] [311086] (4 PDB entries) |
Domain d2o6cb_: 2o6c B: [304255] complexed with cl, edo, so4 |
PDB Entry: 2o6c (more details), 1.7 Å
SCOPe Domain Sequences for d2o6cb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o6cb_ b.1.33.1 (B:) Tp34 lipoprotein {Treponema pallidum [TaxId: 160]} defpigedrdvgplhvggvyfqpvemhpapgaqpskeeadchieadihaneagkdlgygv gdfvpylrvvaflqkhgsekvqkvmfapmnagdgphyganvkfeeglgtykvrfeiaaps hdeyslhideqtgvsgrfwseplvaewddfewkgpqw
Timeline for d2o6cb_: