SCOPe 2.06: Domain d2o6cb_: 2o6c B:

Lineage for d2o6cb_ (2o6c B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.33: Membrane antigen precursor-like [310605] (2 families)
   Pfam PF10634

5. Family b.1.33.1: Membrane antigen precursor-like [310656] (2 proteins)

6. Protein Tp34 lipoprotein [310819] (1 species)

7. Species Treponema pallidum [TaxId:160] [311086] (4 PDB entries)

8. Domain d2o6cb_: 2o6c B: [304255]
   complexed with cl, edo, so4

Details for d2o6cb_

PDB Entry: 2o6c, 1.7 Å

PDB Description: structure of selenomethionyl rtp34 from treponema pallidum

PDB Compounds: (B:) 34 kDa membrane antigen

SCOPe Domain Sequences for d2o6cb_:

Sequence; same for both SEQRES and ATOM records:

>d2o6cb_ b.1.33.1 (B:) Tp34 lipoprotein {Treponema pallidum [TaxId: 160]}
defpigedrdvgplhvggvyfqpvemhpapgaqpskeeadchieadihaneagkdlgygv
gdfvpylrvvaflqkhgsekvqkvmfapmnagdgphyganvkfeeglgtykvrfeiaaps
hdeyslhideqtgvsgrfwseplvaewddfewkgpqw

Timeline for d2o6cb_:

• d2o6cb_ is new in SCOPe 2.06-stable
  
• d2o6cb_ appears in SCOPe 2.07
  
• d2o6cb_ appears in the current release, SCOPe 2.08