Lineage for d2o6cb_ (2o6c B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2767114Superfamily b.1.33: Membrane antigen precursor-like [310605] (2 families) (S)
    Pfam PF10634
  5. 2767115Family b.1.33.1: Membrane antigen precursor-like [310656] (2 proteins)
  6. 2767116Protein Tp34 lipoprotein [310819] (1 species)
  7. 2767117Species Treponema pallidum [TaxId:160] [311086] (4 PDB entries)
  8. 2767121Domain d2o6cb_: 2o6c B: [304255]
    complexed with cl, edo, so4

Details for d2o6cb_

PDB Entry: 2o6c (more details), 1.7 Å

PDB Description: structure of selenomethionyl rtp34 from treponema pallidum
PDB Compounds: (B:) 34 kDa membrane antigen

SCOPe Domain Sequences for d2o6cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o6cb_ b.1.33.1 (B:) Tp34 lipoprotein {Treponema pallidum [TaxId: 160]}
defpigedrdvgplhvggvyfqpvemhpapgaqpskeeadchieadihaneagkdlgygv
gdfvpylrvvaflqkhgsekvqkvmfapmnagdgphyganvkfeeglgtykvrfeiaaps
hdeyslhideqtgvsgrfwseplvaewddfewkgpqw

SCOPe Domain Coordinates for d2o6cb_:

Click to download the PDB-style file with coordinates for d2o6cb_.
(The format of our PDB-style files is described here.)

Timeline for d2o6cb_: