Lineage for d2o37a_ (2o37 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303207Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2303330Superfamily a.2.3: Chaperone J-domain [46565] (2 families) (S)
  5. 2303366Family a.2.3.0: automated matches [191473] (1 protein)
    not a true family
  6. 2303367Protein automated matches [190750] (8 species)
    not a true protein
  7. 2303368Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [311231] (2 PDB entries)
  8. 2303369Domain d2o37a_: 2o37 A: [304253]
    automated match to d4rwua_

Details for d2o37a_

PDB Entry: 2o37 (more details), 1.25 Å

PDB Description: J-domain of Sis1 protein, Hsp40 co-chaperone from Saccharomyces cerevisiae.
PDB Compounds: (A:) Protein SIS1

SCOPe Domain Sequences for d2o37a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o37a_ a.2.3.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mvketklydllgvspsaneqelkkgyrkaalkyhpdkptgdtekfkeiseafeilndpqk
reiydqygleaarsggpsfgp

SCOPe Domain Coordinates for d2o37a_:

Click to download the PDB-style file with coordinates for d2o37a_.
(The format of our PDB-style files is described here.)

Timeline for d2o37a_: