![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.3: Chaperone J-domain [46565] (2 families) ![]() |
![]() | Family a.2.3.0: automated matches [191473] (1 protein) not a true family |
![]() | Protein automated matches [190750] (8 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [311231] (2 PDB entries) |
![]() | Domain d2o37a_: 2o37 A: [304253] automated match to d4rwua_ |
PDB Entry: 2o37 (more details), 1.25 Å
SCOPe Domain Sequences for d2o37a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o37a_ a.2.3.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mvketklydllgvspsaneqelkkgyrkaalkyhpdkptgdtekfkeiseafeilndpqk reiydqygleaarsggpsfgp
Timeline for d2o37a_: