SCOPe 2.08: Domain d2nytb1: 2nyt B:41-224

Lineage for d2nytb1 (2nyt B:41-224)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.6: apolipoprotein B messenger RNA-editing enzyme catalytic (APOBEC) cytidine deaminase domains [310632] (5 proteins)
   strand 5 is parallel to strand 4
   Pfam PF08210; Pfam PF05240

6. Protein APOBEC2 (APO2) [310756] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [311011] (1 PDB entry)

8. Domain d2nytb1: 2nyt B:41-224 [304235]
   Other proteins in same PDB: d2nyta2, d2nytb2, d2nytc2, d2nytd2
   complexed with zn

Details for d2nytb1

PDB Entry: 2nyt, 2.5 Å

PDB Description: The APOBEC2 Crystal Structure and Functional Implications for AID

PDB Compounds: (B:) Probable C->U-editing enzyme APOBEC-2

SCOPe Domain Sequences for d2nytb1:

Sequence; same for both SEQRES and ATOM records:

>d2nytb1 c.97.1.6 (B:41-224) APOBEC2 (APO2) {Human (Homo sapiens) [TaxId: 9606]}
ivtgerlpanffkfqfrnveyssgrnktflcyvveaqgkggqvqasrgyledehaaahae
eaffntilpafdpalrynvtwyvssspcaacadriiktlsktknlrllilvgrlfmweep
eiqaalkklkeagcklrimkpqdfeyvwqnfveqeegeskafqpwediqenflyyeekla
dilk

Timeline for d2nytb1:

• d2nytb1 first appeared in SCOPe 2.06
  
• d2nytb1 appears in SCOPe 2.07