Lineage for d2nytb1 (2nyt B:41-224)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918482Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2918718Family c.97.1.6: apolipoprotein B messenger RNA-editing enzyme catalytic (APOBEC) cytidine deaminase domains [310632] (5 proteins)
    strand 5 is parallel to strand 4
    Pfam PF08210; Pfam PF05240
  6. 2918719Protein APOBEC2 (APO2) [310756] (1 species)
  7. 2918720Species Human (Homo sapiens) [TaxId:9606] [311011] (1 PDB entry)
  8. 2918722Domain d2nytb1: 2nyt B:41-224 [304235]
    Other proteins in same PDB: d2nyta2, d2nytb2, d2nytc2, d2nytd2
    complexed with zn

Details for d2nytb1

PDB Entry: 2nyt (more details), 2.5 Å

PDB Description: The APOBEC2 Crystal Structure and Functional Implications for AID
PDB Compounds: (B:) Probable C->U-editing enzyme APOBEC-2

SCOPe Domain Sequences for d2nytb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nytb1 c.97.1.6 (B:41-224) APOBEC2 (APO2) {Human (Homo sapiens) [TaxId: 9606]}
ivtgerlpanffkfqfrnveyssgrnktflcyvveaqgkggqvqasrgyledehaaahae
eaffntilpafdpalrynvtwyvssspcaacadriiktlsktknlrllilvgrlfmweep
eiqaalkklkeagcklrimkpqdfeyvwqnfveqeegeskafqpwediqenflyyeekla
dilk

SCOPe Domain Coordinates for d2nytb1:

Click to download the PDB-style file with coordinates for d2nytb1.
(The format of our PDB-style files is described here.)

Timeline for d2nytb1: