![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
![]() | Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) ![]() contains extra C-terminal strand 5, order 21345 |
![]() | Family c.97.1.6: apolipoprotein B messenger RNA-editing enzyme catalytic (APOBEC) cytidine deaminase domains [310632] (5 proteins) strand 5 is parallel to strand 4 Pfam PF08210; Pfam PF05240 |
![]() | Protein APOBEC2 (APO2) [310756] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [311011] (1 PDB entry) |
![]() | Domain d2nytb1: 2nyt B:41-224 [304235] Other proteins in same PDB: d2nyta2, d2nytb2, d2nytc2, d2nytd2 complexed with zn |
PDB Entry: 2nyt (more details), 2.5 Å
SCOPe Domain Sequences for d2nytb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nytb1 c.97.1.6 (B:41-224) APOBEC2 (APO2) {Human (Homo sapiens) [TaxId: 9606]} ivtgerlpanffkfqfrnveyssgrnktflcyvveaqgkggqvqasrgyledehaaahae eaffntilpafdpalrynvtwyvssspcaacadriiktlsktknlrllilvgrlfmweep eiqaalkklkeagcklrimkpqdfeyvwqnfveqeegeskafqpwediqenflyyeekla dilk
Timeline for d2nytb1: