SCOPe 2.06: Domain d1gnda1: 1gnd A:1-291,A:389-430

Lineage for d1gnda1 (1gnd A:1-291,A:389-430)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.3: GDI-like N domain [51931] (3 proteins)
   Similar to FAD-linked reductases in both domains but does not bind FAD

6. Protein Guanine nucleotide dissociation inhibitor, GDI [51932] (2 species)
   the inhibition function is probably associated with an insert subdomain, residues 120-220

7. Species Cow (Bos taurus) [TaxId:9913] [51933] (3 PDB entries)

8. Domain d1gnda1: 1gnd A:1-291,A:389-430 [30423]
   Other proteins in same PDB: d1gnda2

Details for d1gnda1

PDB Entry: 1gnd, 1.81 Å

PDB Description: guanine nucleotide dissociation inhibitor, alpha-isoform

PDB Compounds: (A:) guanine nucleotide dissociation inhibitor

SCOPe Domain Sequences for d1gnda1:

Sequence; same for both SEQRES and ATOM records:

>d1gnda1 c.3.1.3 (A:1-291,A:389-430) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]}
mdeeydvivlgtgltecilsgimsvngkkvlhmdrnpyyggesssitpleelykrfqlle
gppetmgrgrdwnvdlipkflmangqlvkmllytevtryldfkvvegsfvykggkiykvp
stetealasnlmgmfekrrfrkflvfvanfdendpktfegvdpqntsmrdvyrkfdlgqd
vidftghalalyrtddyldqpcletinriklyseslarygkspylyplyglgelpqgfar
lsaiyggtymlnkpvddiimengkvvgvksegevarckqlicdpsyvpdrvXpiddgses
qvfcscsydatthfettcndikdiykrmagsafd

Timeline for d1gnda1:

• d1gnda1 first appeared (with stable ids) in SCOP 1.55, called d1gnd_1
  
• d1gnda1 appears in SCOPe 2.05
  
• d1gnda1 appears in SCOPe 2.07
  
• d1gnda1 appears in the current release, SCOPe 2.08