Lineage for d1gnda1 (1gnd A:1-291,A:389-430)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1351449Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1351450Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) (S)
  5. 1351839Family c.3.1.3: GDI-like N domain [51931] (2 proteins)
    Similar to FAD-linked reductases in both domains but does not bind FAD
  6. 1351840Protein Guanine nucleotide dissociation inhibitor, GDI [51932] (2 species)
    the inhibition function is probably associated with an insert subdomain, residues 120-220
  7. 1351856Species Cow (Bos taurus) [TaxId:9913] [51933] (3 PDB entries)
  8. 1351858Domain d1gnda1: 1gnd A:1-291,A:389-430 [30423]
    Other proteins in same PDB: d1gnda2

Details for d1gnda1

PDB Entry: 1gnd (more details), 1.81 Å

PDB Description: guanine nucleotide dissociation inhibitor, alpha-isoform
PDB Compounds: (A:) guanine nucleotide dissociation inhibitor

SCOPe Domain Sequences for d1gnda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gnda1 c.3.1.3 (A:1-291,A:389-430) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]}
mdeeydvivlgtgltecilsgimsvngkkvlhmdrnpyyggesssitpleelykrfqlle
gppetmgrgrdwnvdlipkflmangqlvkmllytevtryldfkvvegsfvykggkiykvp
stetealasnlmgmfekrrfrkflvfvanfdendpktfegvdpqntsmrdvyrkfdlgqd
vidftghalalyrtddyldqpcletinriklyseslarygkspylyplyglgelpqgfar
lsaiyggtymlnkpvddiimengkvvgvksegevarckqlicdpsyvpdrvXpiddgses
qvfcscsydatthfettcndikdiykrmagsafd

SCOPe Domain Coordinates for d1gnda1:

Click to download the PDB-style file with coordinates for d1gnda1.
(The format of our PDB-style files is described here.)

Timeline for d1gnda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gnda2