Lineage for d2nr8a_ (2nr8 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114207Species Human (Homo sapiens) [TaxId:9606] [186862] (124 PDB entries)
  8. 2114264Domain d2nr8a_: 2nr8 A: [304226]
    automated match to d3nwna_
    complexed with adp, cl, mg, unx

Details for d2nr8a_

PDB Entry: 2nr8 (more details), 2 Å

PDB Description: Crystal structure of the human KIF9 motor domain in complex with ADP
PDB Compounds: (A:) Kinesin-like protein KIF9

SCOPe Domain Sequences for d2nr8a_:

Sequence, based on SEQRES records: (download)

>d2nr8a_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkvhafvrvkptddfahemirygddkrsidihlkkdirrgvvnnqqtdwsfkldgvlhda
sqdlvyetvakdvvsqaldgyngtimcygqtgagktytmmgatenykhrgilpralqqvf
rmieerpthaitvrvsyleiyneslfdllstlpyvgpsvtpmtivenpqgvfikglsvhl
tsqeedafsllfegetnriiashtmnknssrshciftiyleahsrtlseekyitskinlv
dlagserlgksgsegqvlkeatyinkslsfleqaiialgdqkrdhipfrqcklthalkds
lggncnmvlvtniygeaaqleetlsslrfasrmklv

Sequence, based on observed residues (ATOM records): (download)

>d2nr8a_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkvhafvrvkptddfahemirygddkrsidihlkkdirrgvvnnqqtdwsfkldgvlhda
sqdlvyetvakdvvsqaldgyngtimcygqtgagktytmmgatenykhrgilpralqqvf
rmieerpthaitvrvsyleiyneslfdllstlpyvgpsvtpmtivenpqgvfikglsvhl
tsqeedafsllfegetnriiashtmnknssrshciftiyleahkyitskinlvdlagsey
inkslsfleqaiialgdipfrqcklthalkdslggncnmvlvtniygeaaqleetlsslr
fasrmklv

SCOPe Domain Coordinates for d2nr8a_:

Click to download the PDB-style file with coordinates for d2nr8a_.
(The format of our PDB-style files is described here.)

Timeline for d2nr8a_:

  • d2nr8a_ is new in SCOPe 2.06-stable