SCOPe 2.08: Domain d2nr3a2: 2nr3 A:97-180

Lineage for d2nr3a2 (2nr3 A:97-180)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.75: PSPTO2686-like [158311] (1 protein)
   Pfam PF04337; DUF480; duplication: two "winged helix" domains are tightly packed "back-to-back" about pseudo twofold axis

6. Protein Hypothetical protein PSPTO2686 [158312] (1 species)

7. Species Pseudomonas syringae pv. tomato [TaxId:323] [158313] (2 PDB entries)
   Uniprot Q882E2 13-96! Uniprot Q882E2 97-180

8. Domain d2nr3a2: 2nr3 A:97-180 [304225]
   automated match to d3bz6a2

Details for d2nr3a2

PDB Entry: 2nr3, 2.21 Å

PDB Description: Crystal structure of a Conserved Protein of Unknown Function from Pseudomonas syringae pv. tomato str. DC3000, Probable Transcription Factor

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2nr3a2:

Sequence; same for both SEQRES and ATOM records:

>d2nr3a2 a.4.5.75 (A:97-180) Hypothetical protein PSPTO2686 {Pseudomonas syringae pv. tomato [TaxId: 323]}
vdkglelvpaqviltgllllrgpqtvselltrsnrmhdfedseqvvhqlerliarglatl
vprqsgqredrymhligdpedlqd

Timeline for d2nr3a2:

• d2nr3a2 first appeared in SCOPe 2.06
  
• d2nr3a2 appears in SCOPe 2.07