| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.75: PSPTO2686-like [158311] (1 protein) Pfam PF04337; DUF480; duplication: two "winged helix" domains are tightly packed "back-to-back" about pseudo twofold axis |
| Protein Hypothetical protein PSPTO2686 [158312] (1 species) |
| Species Pseudomonas syringae pv. tomato [TaxId:323] [158313] (2 PDB entries) Uniprot Q882E2 13-96! Uniprot Q882E2 97-180 |
| Domain d2nr3a1: 2nr3 A:13-96 [304224] automated match to d3bz6a1 |
PDB Entry: 2nr3 (more details), 2.21 Å
SCOPe Domain Sequences for d2nr3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nr3a1 a.4.5.75 (A:13-96) Hypothetical protein PSPTO2686 {Pseudomonas syringae pv. tomato [TaxId: 323]}
naealqlnstevrilgcliekqatnpetypltlnalviacnqktsrdpvmnltqgqvgqs
lralegrgltrlvmgsradrwehk
Timeline for d2nr3a1: