Lineage for d1d5ta1 (1d5t A:-2-291,A:389-431)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 20781Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 20782Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 20917Family c.3.1.3: Guanine nucleotide dissosiation inhibitor, GDI [51931] (1 protein)
  6. 20918Protein Guanine nucleotide dissosiation inhibitor, GDI [51932] (1 species)
  7. 20919Species Cow (Bos taurus) [TaxId:9913] [51933] (2 PDB entries)
  8. 20920Domain d1d5ta1: 1d5t A:-2-291,A:389-431 [30422]
    Other proteins in same PDB: d1d5ta2

Details for d1d5ta1

PDB Entry: 1d5t (more details), 1.04 Å

PDB Description: guanine nucleotide dissociation inhibitor, alpha-isoform

SCOP Domain Sequences for d1d5ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissosiation inhibitor, GDI {Cow (Bos taurus)}
hhmdeeydvivlgtgltecilsgimsvngkkvlhmdrnpyyggesssitpleelykrfql
legppetmgrgrdwnvdlipkflmangqlvkmllytevtryldfkvvegsfvykggkiyk
vpstetealasnlmgmfekrrfrkflvfvanfdendpktfegvdpqntsmrdvyrkfdlg
qdvidftghalalyrtddyldqpcletinriklyseslarygkspylyplyglgelpqgf
arlsaiyggtymlnkpvddiimengkvvgvksegevarckqlicdpsyvpdrvXpiddgs
esqvfcscsydatthfettcndikdiykrmagsafdf

SCOP Domain Coordinates for d1d5ta1:

Click to download the PDB-style file with coordinates for d1d5ta1.
(The format of our PDB-style files is described here.)

Timeline for d1d5ta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d5ta2