SCOPe 2.08: Domain d1d5ta1: 1d5t A:-2-291,A:389-431

Lineage for d1d5ta1 (1d5t A:-2-291,A:389-431)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.3: GDI-like N domain [51931] (3 proteins)
   Similar to FAD-linked reductases in both domains but does not bind FAD

6. Protein Guanine nucleotide dissociation inhibitor, GDI [51932] (2 species)
   the inhibition function is probably associated with an insert subdomain, residues 120-220

7. Species Cow (Bos taurus) [TaxId:9913] [51933] (3 PDB entries)

8. Domain d1d5ta1: 1d5t A:-2-291,A:389-431 [30422]
   Other proteins in same PDB: d1d5ta2
   complexed with so4

Details for d1d5ta1

PDB Entry: 1d5t, 1.04 Å

PDB Description: guanine nucleotide dissociation inhibitor, alpha-isoform

PDB Compounds: (A:) guanine nucleotide dissociation inhibitor

SCOPe Domain Sequences for d1d5ta1:

Sequence; same for both SEQRES and ATOM records:

>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]}
hhmdeeydvivlgtgltecilsgimsvngkkvlhmdrnpyyggesssitpleelykrfql
legppetmgrgrdwnvdlipkflmangqlvkmllytevtryldfkvvegsfvykggkiyk
vpstetealasnlmgmfekrrfrkflvfvanfdendpktfegvdpqntsmrdvyrkfdlg
qdvidftghalalyrtddyldqpcletinriklyseslarygkspylyplyglgelpqgf
arlsaiyggtymlnkpvddiimengkvvgvksegevarckqlicdpsyvpdrvXpiddgs
esqvfcscsydatthfettcndikdiykrmagsafdf

Timeline for d1d5ta1:

• d1d5ta1 first appeared (with stable ids) in SCOP 1.55
  
• d1d5ta1 appears in SCOPe 2.07