![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) ![]() duplication: contains multiple CxxCH motifs |
![]() | Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins) |
![]() | Protein Cytochrome c7 (cytochrome c551.5, PpcA) [48703] (3 species) contains three heme groups; deletion of one of Cyt c3 heme-binding sites |
![]() | Species Desulfuromonas acetoxidans [TaxId:891] [48704] (8 PDB entries) |
![]() | Domain d2newa_: 2new A: [304219] automated match to d1hh5a_ complexed with hec |
PDB Entry: 2new (more details)
SCOPe Domain Sequences for d2newa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2newa_ a.138.1.1 (A:) Cytochrome c7 (cytochrome c551.5, PpcA) {Desulfuromonas acetoxidans [TaxId: 891]} advvtyenkkgnvtfdhkahaeklgcdachegtpakiaidkksahkdacktchksnngpt kcggchik
Timeline for d2newa_: