Lineage for d2newa_ (2new A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2339824Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 2339825Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2339826Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)
  6. 2339883Protein Cytochrome c7 (cytochrome c551.5, PpcA) [48703] (3 species)
    contains three heme groups; deletion of one of Cyt c3 heme-binding sites
  7. 2339884Species Desulfuromonas acetoxidans [TaxId:891] [48704] (8 PDB entries)
  8. 2339890Domain d2newa_: 2new A: [304219]
    automated match to d1hh5a_
    complexed with hec

Details for d2newa_

PDB Entry: 2new (more details)

PDB Description: cytochrome c551.5, nmr, structures 19-35 of 35
PDB Compounds: (A:) cytochrome c551.5

SCOPe Domain Sequences for d2newa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2newa_ a.138.1.1 (A:) Cytochrome c7 (cytochrome c551.5, PpcA) {Desulfuromonas acetoxidans [TaxId: 891]}
advvtyenkkgnvtfdhkahaeklgcdachegtpakiaidkksahkdacktchksnngpt
kcggchik

SCOPe Domain Coordinates for d2newa_:

Click to download the PDB-style file with coordinates for d2newa_.
(The format of our PDB-style files is described here.)

Timeline for d2newa_: