Class b: All beta proteins [48724] (177 folds) |
Fold b.129: Double-split beta-barrel [89446] (2 superfamilies) pseudobarrel; capped on both ends by alpha-helices |
Superfamily b.129.1: AbrB/MazE/MraZ-like [89447] (3 families) members of this superfamily are known or predicted to have DNA-binding function |
Family b.129.1.1: Kis/PemI addiction antidote [89448] (2 proteins) forms intertwined homodimer |
Protein automated matches [310856] (1 species) not a true protein |
Species Escherichia coli [TaxId:83333] [311226] (1 PDB entry) |
Domain d2mrua1: 2mru A:2-50 [304208] Other proteins in same PDB: d2mrua2, d2mrub2 automated match to d1mvfd_ protein/DNA complex |
PDB Entry: 2mru (more details)
SCOPe Domain Sequences for d2mrua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mrua1 b.129.1.1 (A:2-50) automated matches {Escherichia coli [TaxId: 83333]} ihssvkrwgnspavripatlmqalnlniddevkidlvdgkliiepvrke
Timeline for d2mrua1: