SCOPe 2.06: Domain d2mrua1: 2mru A:2-50

Lineage for d2mrua1 (2mru A:2-50)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.129: Double-split beta-barrel [89446] (2 superfamilies)
   pseudobarrel; capped on both ends by alpha-helices

4. Superfamily b.129.1: AbrB/MazE/MraZ-like [89447] (3 families)
   members of this superfamily are known or predicted to have DNA-binding function

5. Family b.129.1.1: Kis/PemI addiction antidote [89448] (2 proteins)
   forms intertwined homodimer

6. Protein automated matches [310856] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [311226] (1 PDB entry)

8. Domain d2mrua1: 2mru A:2-50 [304208]
   Other proteins in same PDB: d2mrua2, d2mrub2
   automated match to d1mvfd_
   protein/DNA complex

Details for d2mrua1

PDB Entry: 2mru

PDB Description: Structure of truncated EcMazE-DNA complex

PDB Compounds: (A:) Antitoxin MazE

SCOPe Domain Sequences for d2mrua1:

Sequence; same for both SEQRES and ATOM records:

>d2mrua1 b.129.1.1 (A:2-50) automated matches {Escherichia coli [TaxId: 83333]}
ihssvkrwgnspavripatlmqalnlniddevkidlvdgkliiepvrke

Timeline for d2mrua1:

• d2mrua1 is new in SCOPe 2.06-stable
  
• d2mrua1 appears in SCOPe 2.07
  
• d2mrua1 appears in the current release, SCOPe 2.08