Class b: All beta proteins [48724] (177 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins) barrel, closed; n=5, S=8 |
Protein automated matches [190915] (10 species) not a true protein |
Species Thermus aquaticus [TaxId:498848] [311225] (2 PDB entries) |
Domain d2mo0a_: 2mo0 A: [304206] automated match to d1c9oa_ |
PDB Entry: 2mo0 (more details)
SCOPe Domain Sequences for d2mo0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mo0a_ b.40.4.5 (A:) automated matches {Thermus aquaticus [TaxId: 498848]} mkkgtvkwfnaekgygfiqqeegpdvfvhftaieadgfrtlnegehvefevepgrggkgp qakkvrri
Timeline for d2mo0a_: