Lineage for d2mo0a_ (2mo0 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2059387Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2059775Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 2060250Protein automated matches [190915] (10 species)
    not a true protein
  7. 2060272Species Thermus aquaticus [TaxId:498848] [311225] (2 PDB entries)
  8. 2060274Domain d2mo0a_: 2mo0 A: [304206]
    automated match to d1c9oa_

Details for d2mo0a_

PDB Entry: 2mo0 (more details)

PDB Description: backbone 1h, 13c, and 15n chemical shift assignments for cold shock protein, tacsp
PDB Compounds: (A:) Cold-shock DNA-binding domain protein

SCOPe Domain Sequences for d2mo0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mo0a_ b.40.4.5 (A:) automated matches {Thermus aquaticus [TaxId: 498848]}
mkkgtvkwfnaekgygfiqqeegpdvfvhftaieadgfrtlnegehvefevepgrggkgp
qakkvrri

SCOPe Domain Coordinates for d2mo0a_:

Click to download the PDB-style file with coordinates for d2mo0a_.
(The format of our PDB-style files is described here.)

Timeline for d2mo0a_: