| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein automated matches [190359] (43 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188371] (10 PDB entries) |
| Domain d2mm1a_: 2mm1 A: [304204] automated match to d1myha_ complexed with hem; mutant |
PDB Entry: 2mm1 (more details), 2.8 Å
SCOPe Domain Sequences for d2mm1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mm1a_ a.1.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glsdgewqlvlnvwgkveadipghgqevlirlfkghpetlekfdrfkhlksedemkased
lkkhgatvltalggilkkkghheaeikplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamnkalelfrkdmasnykelgfqg
Timeline for d2mm1a_: