Lineage for d2mj3a_ (2mj3 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2934202Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 2934203Protein automated matches [191164] (24 species)
    not a true protein
  7. 2934244Species Ehrlichia chaffeensis [TaxId:205920] [311224] (1 PDB entry)
  8. 2934245Domain d2mj3a_: 2mj3 A: [304203]
    automated match to d2mjea_

Details for d2mj3a_

PDB Entry: 2mj3 (more details)

PDB Description: backbone 1h, 13c, and 15n chemical shift assignments and structure of iron-sulfur cluster binding protein from ehrlichia chaffeensis
PDB Compounds: (A:) iron-sulfur cluster binding protein

SCOPe Domain Sequences for d2mj3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mj3a_ d.15.4.0 (A:) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
mplitfispdgsrktyeaydgetllslahrnnvdlegacegslacstchviidpswydiv
eqhneisdeendmldlafgltdtsrlgcqiiltkeldglcvilptetrnisfvkns

SCOPe Domain Coordinates for d2mj3a_:

Click to download the PDB-style file with coordinates for d2mj3a_.
(The format of our PDB-style files is described here.)

Timeline for d2mj3a_: