SCOPe 2.07: Domain d2mj3a_: 2mj3 A:

Lineage for d2mj3a_ (2mj3 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.0: automated matches [191632] (1 protein)
   not a true family

6. Protein automated matches [191164] (22 species)
   not a true protein

7. Species Ehrlichia chaffeensis [TaxId:205920] [311224] (1 PDB entry)

8. Domain d2mj3a_: 2mj3 A: [304203]
   automated match to d2mjea_

Details for d2mj3a_

PDB Entry: 2mj3

PDB Description: backbone 1h, 13c, and 15n chemical shift assignments and structure of iron-sulfur cluster binding protein from ehrlichia chaffeensis

PDB Compounds: (A:) iron-sulfur cluster binding protein

SCOPe Domain Sequences for d2mj3a_:

Sequence; same for both SEQRES and ATOM records:

>d2mj3a_ d.15.4.0 (A:) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
mplitfispdgsrktyeaydgetllslahrnnvdlegacegslacstchviidpswydiv
eqhneisdeendmldlafgltdtsrlgcqiiltkeldglcvilptetrnisfvkns

Timeline for d2mj3a_:

• d2mj3a_ first appeared in SCOPe 2.06