![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.0: automated matches [191632] (1 protein) not a true family |
![]() | Protein automated matches [191164] (24 species) not a true protein |
![]() | Species Ehrlichia chaffeensis [TaxId:205920] [311224] (1 PDB entry) |
![]() | Domain d2mj3a_: 2mj3 A: [304203] automated match to d2mjea_ |
PDB Entry: 2mj3 (more details)
SCOPe Domain Sequences for d2mj3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mj3a_ d.15.4.0 (A:) automated matches {Ehrlichia chaffeensis [TaxId: 205920]} mplitfispdgsrktyeaydgetllslahrnnvdlegacegslacstchviidpswydiv eqhneisdeendmldlafgltdtsrlgcqiiltkeldglcvilptetrnisfvkns
Timeline for d2mj3a_: