![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.71: ERP29 C domain-like [47932] (2 superfamilies) 5 helices; bundle |
![]() | Superfamily a.71.1: ERP29 C domain-like [47933] (2 families) ![]() automatically mapped to Pfam PF07749 |
![]() | Family a.71.1.1: ERP29 C domain-like [47934] (3 proteins) |
![]() | Protein Endoplasmic reticulum protein ERP29, C-terminal domain [47935] (1 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [47936] (2 PDB entries) |
![]() | Domain d2m66a_: 2m66 A: [304195] automated match to d1g7da_ |
PDB Entry: 2m66 (more details)
SCOPe Domain Sequences for d2m66a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2m66a_ a.71.1.1 (A:) Endoplasmic reticulum protein ERP29, C-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} pgclpaydalagqfieassrearqailkqgqdglsgvketdkkwasqylkimgkildqge dfpaselarisklienkmsegkkeelqrslniltafrkkgaekeel
Timeline for d2m66a_: