Lineage for d2m65a_ (2m65 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918482Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2918718Family c.97.1.6: apolipoprotein B messenger RNA-editing enzyme catalytic (APOBEC) cytidine deaminase domains [310632] (5 proteins)
    strand 5 is parallel to strand 4
    Pfam PF08210; Pfam PF05240
  6. 2918725Protein APOBEC3A [310759] (1 species)
  7. 2918726Species Human (Homo sapiens) [TaxId:9606] [311014] (2 PDB entries)
  8. 2918729Domain d2m65a_: 2m65 A: [304194]
    automated match to d4xxoa_
    complexed with zn

Details for d2m65a_

PDB Entry: 2m65 (more details)

PDB Description: NMR structure of human restriction factor APOBEC3A
PDB Compounds: (A:) Probable DNA dC->dU-editing enzyme APOBEC-3A

SCOPe Domain Sequences for d2m65a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m65a_ c.97.1.6 (A:) APOBEC3A {Human (Homo sapiens) [TaxId: 9606]}
measpasgprhlmdphiftsnfnngigrhktylcyeverldngtsvkmdqhrgflhnqak
nllcgfygrhaelrfldlvpslqldpaqiyrvtwfiswspcfswgcagevraflqenthv
rlrifaariydydplykealqmlrdagaqvsimtydefkhcwdtfvdhqgcpfqpwdgld
ehsqalsgrlrailqnqgn

SCOPe Domain Coordinates for d2m65a_:

Click to download the PDB-style file with coordinates for d2m65a_.
(The format of our PDB-style files is described here.)

Timeline for d2m65a_: