SCOPe 2.08: Domain d2m1ua1: 2m1u A:22-93

Lineage for d2m1ua1 (2m1u A:22-93)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (36 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255121] (3 PDB entries)

8. Domain d2m1ua1: 2m1u A:22-93 [304192]
   Other proteins in same PDB: d2m1ua2
   automated match to d2m8ua_

Details for d2m1ua1

PDB Entry: 2m1u

PDB Description: Solution structure of the small dictyostelium discoideium myosin light chain mlcb provides insights into iq-motif recognition of class i myosin myo1b

PDB Compounds: (A:) myosin light chain MlcB

SCOPe Domain Sequences for d2m1ua1:

Sequence; same for both SEQRES and ATOM records:

>d2m1ua1 a.39.1.0 (A:22-93) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sdektqlieafynfdgdydgfvsveefrgiirdglpmteaeiteffeaadpnntgfidyk
afaamlysvdes

Timeline for d2m1ua1:

• d2m1ua1 first appeared in SCOPe 2.06
  
• d2m1ua1 appears in SCOPe 2.07