SCOP 1.73: Domain d1f8sf1: 1f8s F:5-319,F:433-486

Lineage for d1f8sf1 (1f8s F:5-319,F:433-486)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (7 families)

5. Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (15 proteins)
   C-terminal domain is alpha+beta is common for the family

6. Protein L-aminoacid oxidase [51929] (2 species)

7. Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [51930] (3 PDB entries)

8. Domain d1f8sf1: 1f8s F:5-319,F:433-486 [30419]
   Other proteins in same PDB: d1f8sa2, d1f8sb2, d1f8sc2, d1f8sd2, d1f8se2, d1f8sf2, d1f8sg2, d1f8sh2

Details for d1f8sf1

PDB Entry: 1f8s, 2 Å

PDB Description: crystal structure of l-amino acid oxidase from calloselasma rhodostoma, complexed with three molecules of o-aminobenzoate.

PDB Compounds: (F:) l-amino acid oxidase

SCOP Domain Sequences for d1f8sf1:

Sequence; same for both SEQRES and ATOM records:

>d1f8sf1 c.3.1.2 (F:5-319,F:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}
nplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvtvlea
serpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnawyfik
nirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnkydtys
tkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgmdklp
tamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravrlikf
nppllpkkahalrsvXftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglra
ardvnlasen

Timeline for d1f8sf1:

• d1f8sf1 first appeared (with stable ids) in SCOP 1.55
  
• d1f8sf1 appears in SCOP 1.71
  
• d1f8sf1 appears in SCOP 1.75
  
• d1f8sf1 appears in the current release, SCOPe 2.08