Lineage for d2lxka_ (2lxk A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2399296Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
    barrel, closed; n=5, S=8
  6. 2399782Protein automated matches [190915] (12 species)
    not a true protein
  7. 2399788Species Listeria monocytogenes [TaxId:169963] [311222] (2 PDB entries)
  8. 2399790Domain d2lxka_: 2lxk A: [304189]
    automated match to d3cama_

Details for d2lxka_

PDB Entry: 2lxk (more details)

PDB Description: Backbone 1H, 13C, and 15N Chemical Shift Assignments for cold shock protein, LmCsp
PDB Compounds: (A:) Cold shock-like protein CspLA

SCOPe Domain Sequences for d2lxka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lxka_ b.40.4.5 (A:) automated matches {Listeria monocytogenes [TaxId: 169963]}
meqgtvkwfnaekgfgfierengddvfvhfsaiqgdgfksldegqavtfdveegqrgpqa
anvqka

SCOPe Domain Coordinates for d2lxka_:

Click to download the PDB-style file with coordinates for d2lxka_.
(The format of our PDB-style files is described here.)

Timeline for d2lxka_: