Lineage for d2lxja_ (2lxj A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2059387Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2059775Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 2060250Protein automated matches [190915] (10 species)
    not a true protein
  7. 2060253Species Listeria monocytogenes [TaxId:169963] [311222] (2 PDB entries)
  8. 2060254Domain d2lxja_: 2lxj A: [304188]
    automated match to d3cama_

Details for d2lxja_

PDB Entry: 2lxj (more details)

PDB Description: Backbone 1H, 13C, and 15N Chemical Shift Assignments for cold shock protein, LmCsp with dT7
PDB Compounds: (A:) Cold shock-like protein CspLA

SCOPe Domain Sequences for d2lxja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lxja_ b.40.4.5 (A:) automated matches {Listeria monocytogenes [TaxId: 169963]}
meqgtvkwfnaekgfgfierengddvfvhfsaiqgdgfksldegqavtfdveegqrgpqa
anvqka

SCOPe Domain Coordinates for d2lxja_:

Click to download the PDB-style file with coordinates for d2lxja_.
(The format of our PDB-style files is described here.)

Timeline for d2lxja_: