Class a: All alpha proteins [46456] (289 folds) |
Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily) 4 helices; folded leaf; right-handed superhelix |
Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) can be classified as disulfide-rich |
Family a.52.1.0: automated matches [254196] (1 protein) not a true family |
Protein automated matches [254428] (6 species) not a true protein |
Species Common lentil (Lens culinaris) [TaxId:3864] [255496] (3 PDB entries) |
Domain d2ljoa_: 2ljo A: [304183] automated match to d2mala_ |
PDB Entry: 2ljo (more details)
SCOPe Domain Sequences for d2ljoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ljoa_ a.52.1.0 (A:) automated matches {Common lentil (Lens culinaris) [TaxId: 3864]} aiscgavtsdlspcltyltggpgpspqccggvkkllaaanttpdrqaacnclksaagsit klntnnaaalpgkcgvnipykistttncntvkf
Timeline for d2ljoa_: