Lineage for d2lj3a1 (2lj3 A:2-62)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.34: SH3-like barrel [50036] (21 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helix
Superfamily b.34.2: SH3-domain [50044] (2 families) 
Family b.34.2.1: SH3-domain [50045] (40 proteins) 
Protein alpha-Spectrin, SH3 domain [50058] (1 species) Species Chicken (Gallus gallus) [TaxId:9031] [50059] (38 PDB entries) 
Domain d2lj3a1: 2lj3 A:2-62 [304181]
Other proteins in same PDB: d2lj3a2
automated match to d2f2va_
Details for d2lj3a1
PDB Entry: 2lj3 (more details)
PDB Description: PFBD: High-throughput Strategy of Backbone fold Determination for small well-folded proteins in less than a day
PDB Compounds: (A:) Spectrin alpha chain, brainSCOPe Domain Sequences for d2lj3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lj3a1 b.34.2.1 (A:2-62) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]}
detgkelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkkl
d
SCOPe Domain Coordinates for d2lj3a1:
Click to download the PDB-style file with coordinates for d2lj3a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2lj3a1:
- d2lj3a1 first appeared in SCOPe 2.06
- d2lj3a1 appears in SCOPe 2.07
View in 3D
