| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.1: SH3-domain [50045] (40 proteins) |
| Protein alpha-Spectrin, SH3 domain [50058] (1 species) |
| Species Chicken (Gallus gallus) [TaxId:9031] [50059] (38 PDB entries) |
| Domain d2lj3a1: 2lj3 A:2-62 [304181] Other proteins in same PDB: d2lj3a2 automated match to d2f2va_ |
PDB Entry: 2lj3 (more details)
SCOPe Domain Sequences for d2lj3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lj3a1 b.34.2.1 (A:2-62) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]}
detgkelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkkl
d
Timeline for d2lj3a1: