Lineage for d2ldna_ (2ldn A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2061458Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2061459Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 2061755Protein automated matches [190637] (2 species)
    not a true protein
  7. 2061756Species Human (Homo sapiens) [TaxId:9606] [187699] (7 PDB entries)
  8. 2061764Domain d2ldna_: 2ldn A: [304180]
    automated match to d2erma_
    complexed with ssf

Details for d2ldna_

PDB Entry: 2ldn (more details)

PDB Description: Solution structure of FGF1-SSR128129E
PDB Compounds: (A:) heparin-binding growth factor 1

SCOPe Domain Sequences for d2ldna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ldna_ b.42.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylam
dtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygq
kailflplpv

SCOPe Domain Coordinates for d2ldna_:

Click to download the PDB-style file with coordinates for d2ldna_.
(The format of our PDB-style files is described here.)

Timeline for d2ldna_: