Lineage for d2lcea1 (2lce A:12-74)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2261821Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 2261822Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 2262187Family g.37.1.0: automated matches [196454] (1 protein)
    not a true family
  6. 2262188Protein automated matches [196455] (4 species)
    not a true protein
  7. 2262193Species Human (Homo sapiens) [TaxId:9606] [255137] (6 PDB entries)
  8. 2262195Domain d2lcea1: 2lce A:12-74 [304177]
    Other proteins in same PDB: d2lcea2
    automated match to d2n26a_
    complexed with zn

Details for d2lcea1

PDB Entry: 2lce (more details)

PDB Description: Chemical shift assignment of Hr4436B from Homo Sapiens, Northeast Structural Genomics Consortium
PDB Compounds: (A:) B-cell lymphoma 6 protein

SCOPe Domain Sequences for d2lcea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lcea1 g.37.1.0 (A:12-74) automated matches {Human (Homo sapiens) [TaxId: 9606]}
thsdkpykcdrcqasfrykgnlashktvhtgekpyrcnicgaqfnrpanlkthtrihsge
kpy

SCOPe Domain Coordinates for d2lcea1:

Click to download the PDB-style file with coordinates for d2lcea1.
(The format of our PDB-style files is described here.)

Timeline for d2lcea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2lcea2