SCOPe 2.08: Domain d2lcea1: 2lce A:12-74

Lineage for d2lcea1 (2lce A:12-74)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
   simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC

4. Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families)

5. Family g.37.1.0: automated matches [196454] (1 protein)
   not a true family

6. Protein automated matches [196455] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255137] (6 PDB entries)

8. Domain d2lcea1: 2lce A:12-74 [304177]
   Other proteins in same PDB: d2lcea2
   automated match to d2n26a_
   complexed with zn

Details for d2lcea1

PDB Entry: 2lce

PDB Description: Chemical shift assignment of Hr4436B from Homo Sapiens, Northeast Structural Genomics Consortium

PDB Compounds: (A:) B-cell lymphoma 6 protein

SCOPe Domain Sequences for d2lcea1:

Sequence; same for both SEQRES and ATOM records:

>d2lcea1 g.37.1.0 (A:12-74) automated matches {Human (Homo sapiens) [TaxId: 9606]}
thsdkpykcdrcqasfrykgnlashktvhtgekpyrcnicgaqfnrpanlkthtrihsge
kpy

Timeline for d2lcea1:

• d2lcea1 first appeared in SCOPe 2.06
  
• d2lcea1 appears in SCOPe 2.07