Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
Protein automated matches [190513] (30 species) not a true protein |
Species Entamoeba histolytica [TaxId:294381] [255426] (2 PDB entries) |
Domain d2ktga_: 2ktg A: [304170] automated match to d2lc5a_ complexed with ca |
PDB Entry: 2ktg (more details)
SCOPe Domain Sequences for d2ktga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ktga_ a.39.1.0 (A:) automated matches {Entamoeba histolytica [TaxId: 294381]} mseqkkvltaeeqqeykeafqlfdkdndnkltaeelgtvmralganptkqkiseivkdyd kdnsgkfdqetfltimleygqevds
Timeline for d2ktga_: