Lineage for d2ktga_ (2ktg A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711591Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 2711592Protein automated matches [190513] (36 species)
    not a true protein
  7. 2711629Species Entamoeba histolytica [TaxId:294381] [255426] (2 PDB entries)
  8. 2711630Domain d2ktga_: 2ktg A: [304170]
    automated match to d2lc5a_
    complexed with ca

Details for d2ktga_

PDB Entry: 2ktg (more details)

PDB Description: Calmodulin like protein from Entamoeba histolytica: solution structure and calcium binding properties of a partially folded protein
PDB Compounds: (A:) Calmodulin, putative

SCOPe Domain Sequences for d2ktga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ktga_ a.39.1.0 (A:) automated matches {Entamoeba histolytica [TaxId: 294381]}
mseqkkvltaeeqqeykeafqlfdkdndnkltaeelgtvmralganptkqkiseivkdyd
kdnsgkfdqetfltimleygqevds

SCOPe Domain Coordinates for d2ktga_:

Click to download the PDB-style file with coordinates for d2ktga_.
(The format of our PDB-style files is described here.)

Timeline for d2ktga_: