SCOPe 2.08: Domain d2ksxb1: 2ksx B:1-109

Lineage for d2ksxb1 (2ksx B:1-109)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Interferon-alpha/beta receptor beta chain [89199] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89200] (5 PDB entries)

8. Domain d2ksxb1: 2ksx B:1-109 [304168]
   Other proteins in same PDB: d2ksxa_
   automated match to d1n6va1

Details for d2ksxb1

PDB Entry: 2ksx

PDB Description: Inter-molecular interactions in a 44 kDa interferon-receptor complex detected by asymmetric back-protonation and 2D NOESY

PDB Compounds: (B:) Soluble IFN alpha/beta receptor

SCOPe Domain Sequences for d2ksxb1:

Sequence; same for both SEQRES and ATOM records:

>d2ksxb1 b.1.2.1 (B:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}
sydspdytdesctfkislrnfrsilswelknhsivpthytllytimskpedlkvvkncan
ttrsfcdltdewrstheayvtvlegfsgnttlfscshnfwlaidmsfep

Timeline for d2ksxb1:

• d2ksxb1 first appeared in SCOPe 2.06
  
• d2ksxb1 appears in SCOPe 2.07