Lineage for d2ksxa_ (2ksx A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705784Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
    contains an additional helix in one of the crossover connections
  6. 2705785Protein Interferon-alpha 2a [47314] (2 species)
  7. 2705786Species Human (Homo sapiens) [TaxId:9606] [47315] (9 PDB entries)
  8. 2705803Domain d2ksxa_: 2ksx A: [304167]
    Other proteins in same PDB: d2ksxb1, d2ksxb2
    automated match to d1itfa_

Details for d2ksxa_

PDB Entry: 2ksx (more details)

PDB Description: Inter-molecular interactions in a 44 kDa interferon-receptor complex detected by asymmetric back-protonation and 2D NOESY
PDB Compounds: (A:) Interferon alpha-2

SCOPe Domain Sequences for d2ksxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ksxa_ a.26.1.3 (A:) Interferon-alpha 2a {Human (Homo sapiens) [TaxId: 9606]}
cdlpqthslgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhemi
qqifnlfstkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmkedsilavr
kyfqritlylkekkyspcawevvraeimrsfslstnlqeslrske

SCOPe Domain Coordinates for d2ksxa_:

Click to download the PDB-style file with coordinates for d2ksxa_.
(The format of our PDB-style files is described here.)

Timeline for d2ksxa_: