Lineage for d2ks3a_ (2ks3 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2408952Fold b.97: Cytolysin/lectin [63723] (1 superfamily)
    sandwich, 10 strands in 2 sheets;
  4. 2408953Superfamily b.97.1: Cytolysin/lectin [63724] (2 families) (S)
    some topological similarity to osmotin
  5. 2408954Family b.97.1.1: Anemone pore-forming cytolysin [63725] (3 protein domains)
    Pfam PF06369
  6. 2408961Protein Sticholysin II [89268] (1 species)
  7. 2408962Species Carribean sea anemone (Stoichactis helianthus) [TaxId:6123] [89269] (6 PDB entries)
  8. 2408970Domain d2ks3a_: 2ks3 A: [304166]
    automated match to d2l38a_
    mutant

Details for d2ks3a_

PDB Entry: 2ks3 (more details)

PDB Description: NMR structure of StnII R29Q, a defective lipid binding mutant of Sticholysin II
PDB Compounds: (A:) Sticholysin-2

SCOPe Domain Sequences for d2ks3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ks3a_ b.97.1.1 (A:) Sticholysin II {Carribean sea anemone (Stoichactis helianthus) [TaxId: 6123]}
alagtiiagasltfqvldkvleelgkvsqkiavgidnesggtwtalnayfrsgttdvilp
efvpntkallysgrkdtgpvatgavaafayymssgntlgvmfsvpfdynwysnwwdvkiy
sgkrradqgmyedlyygnpyrgdngwheknlgyglrmkgimtsageakmqikisr

SCOPe Domain Coordinates for d2ks3a_:

Click to download the PDB-style file with coordinates for d2ks3a_.
(The format of our PDB-style files is described here.)

Timeline for d2ks3a_: