| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) ![]() |
| Family a.118.9.0: automated matches [191620] (1 protein) not a true family |
| Protein automated matches [191137] (5 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [311220] (1 PDB entry) |
| Domain d2km4a1: 2km4 A:2-131 [304164] Other proteins in same PDB: d2km4a2 automated match to d4fu3a_ |
PDB Entry: 2km4 (more details)
SCOPe Domain Sequences for d2km4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2km4a1 a.118.9.0 (A:2-131) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
afsseqfttklntledsqesissaskwlllqyrdapkvaemwkeymlrpsvntrrkllgl
ylmnhvvqqakgqkiiqfqdsfgkvaaevlgrinqefprdlkkklsrvvnilkernifsk
qvvndiersl
Timeline for d2km4a1: