Lineage for d2km4a1 (2km4 A:2-131)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727055Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. 2727164Family a.118.9.0: automated matches [191620] (1 protein)
    not a true family
  6. 2727165Protein automated matches [191137] (5 species)
    not a true protein
  7. 2727166Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [311220] (1 PDB entry)
  8. 2727167Domain d2km4a1: 2km4 A:2-131 [304164]
    Other proteins in same PDB: d2km4a2
    automated match to d4fu3a_

Details for d2km4a1

PDB Entry: 2km4 (more details)

PDB Description: Solution structure of Rtt103 CTD interacting domain
PDB Compounds: (A:) Regulator of Ty1 transposition protein 103

SCOPe Domain Sequences for d2km4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2km4a1 a.118.9.0 (A:2-131) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
afsseqfttklntledsqesissaskwlllqyrdapkvaemwkeymlrpsvntrrkllgl
ylmnhvvqqakgqkiiqfqdsfgkvaaevlgrinqefprdlkkklsrvvnilkernifsk
qvvndiersl

SCOPe Domain Coordinates for d2km4a1:

Click to download the PDB-style file with coordinates for d2km4a1.
(The format of our PDB-style files is described here.)

Timeline for d2km4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2km4a2