Lineage for d2kboa1 (2kbo A:3-194)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918482Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2918718Family c.97.1.6: apolipoprotein B messenger RNA-editing enzyme catalytic (APOBEC) cytidine deaminase domains [310632] (5 proteins)
    strand 5 is parallel to strand 4
    Pfam PF08210; Pfam PF05240
  6. 2918779Protein automated matches [310855] (2 species)
    not a true protein
  7. 2918780Species Human (Homo sapiens) [TaxId:9606] [311219] (20 PDB entries)
  8. 2918810Domain d2kboa1: 2kbo A:3-194 [304154]
    Other proteins in same PDB: d2kboa2
    automated match to d4xxoa_
    complexed with zn

Details for d2kboa1

PDB Entry: 2kbo (more details)

PDB Description: structure, interaction, and real-time monitoring of the enzymatic reaction of wild type apobec3g
PDB Compounds: (A:) DNA dC->dU-editing enzyme APOBEC-3G

SCOPe Domain Sequences for d2kboa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kboa1 c.97.1.6 (A:3-194) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lrhsmdpptftfnfnnepwvrgrhetylcyevermhndtwvllnqrrgflcnqaphkhgf
legrhaelcfldvipfwkldldqdyrvtcftswspcfscaqemakfisknkhvslcifta
riyddqgrcqeglrtlaeagakisimtysefkhcwdtfvdhqgcpfqpwdgldehsqdls
grlrailqnqen

SCOPe Domain Coordinates for d2kboa1:

Click to download the PDB-style file with coordinates for d2kboa1.
(The format of our PDB-style files is described here.)

Timeline for d2kboa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2kboa2