Lineage for d2k1ca_ (2k1c A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706465Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2706466Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)
  6. 2706472Protein HIV capsid protein, dimerisation domain [47359] (3 species)
  7. 2706495Species Human immunodeficiency virus type 1 [TaxId:11676] [47360] (13 PDB entries)
  8. 2706508Domain d2k1ca_: 2k1c A: [304149]
    automated match to d2l6ea_
    protein/DNA complex; protein/RNA complex

Details for d2k1ca_

PDB Entry: 2k1c (more details)

PDB Description: NMR Structure of the C-terminal domain of HIV-1 Capsid in complex with peptide Inhibitor
PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d2k1ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k1ca_ a.28.3.1 (A:) HIV capsid protein, dimerisation domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
aatleemmtacqgvggpghkarvl

SCOPe Domain Coordinates for d2k1ca_:

Click to download the PDB-style file with coordinates for d2k1ca_.
(The format of our PDB-style files is described here.)

Timeline for d2k1ca_: