Lineage for d2jmqa_ (2jmq A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037862Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
    dimetal(zinc)-bound alpha+beta fold
  4. 3037863Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 3037886Family g.50.1.2: PHD domain [57911] (14 proteins)
  6. 3037890Protein Inhibitor of growth protein 4, Ing4 [118334] (2 species)
  7. 3037891Species Human (Homo sapiens) [TaxId:9606] [161223] (3 PDB entries)
  8. 3037895Domain d2jmqa_: 2jmq A: [304143]
    automated match to d2k1ja_
    complexed with zn

Details for d2jmqa_

PDB Entry: 2jmq (more details)

PDB Description: Plant Homeodomain Finger of the tumour suppressor ING4
PDB Compounds: (A:) Inhibitor of growth protein 4

SCOPe Domain Sequences for d2jmqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jmqa_ g.50.1.2 (A:) Inhibitor of growth protein 4, Ing4 {Human (Homo sapiens) [TaxId: 9606]}
dmpvdpneptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcprcsqerk
kk

SCOPe Domain Coordinates for d2jmqa_:

Click to download the PDB-style file with coordinates for d2jmqa_.
(The format of our PDB-style files is described here.)

Timeline for d2jmqa_: