| Class g: Small proteins [56992] (100 folds) |
| Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) ![]() |
| Family g.50.1.2: PHD domain [57911] (14 proteins) |
| Protein Inhibitor of growth protein 4, Ing4 [118334] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [161223] (3 PDB entries) |
| Domain d2jmqa_: 2jmq A: [304143] automated match to d2k1ja_ complexed with zn |
PDB Entry: 2jmq (more details)
SCOPe Domain Sequences for d2jmqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jmqa_ g.50.1.2 (A:) Inhibitor of growth protein 4, Ing4 {Human (Homo sapiens) [TaxId: 9606]}
dmpvdpneptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcprcsqerk
kk
Timeline for d2jmqa_: