Lineage for d1f8sa1 (1f8s A:5-319,A:433-486)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67065Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 67066Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 67095Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (7 proteins)
  6. 67112Protein L-amino acid oxidase [51929] (1 species)
  7. 67113Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [51930] (2 PDB entries)
  8. 67118Domain d1f8sa1: 1f8s A:5-319,A:433-486 [30414]
    Other proteins in same PDB: d1f8sa2, d1f8sb2, d1f8sc2, d1f8sd2, d1f8se2, d1f8sf2, d1f8sg2, d1f8sh2

Details for d1f8sa1

PDB Entry: 1f8s (more details), 2 Å

PDB Description: crystal structure of l-amino acid oxidase from calloselasma rhodostoma, complexed with three molecules of o-aminobenzoate.

SCOP Domain Sequences for d1f8sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f8sa1 c.3.1.2 (A:5-319,A:433-486) L-amino acid oxidase {Malayan pit viper (Calloselasma rhodostoma)}
nplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvtvlea
serpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnawyfik
nirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnkydtys
tkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgmdklp
tamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravrlikf
nppllpkkahalrsvXftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglra
ardvnlasen

SCOP Domain Coordinates for d1f8sa1:

Click to download the PDB-style file with coordinates for d1f8sa1.
(The format of our PDB-style files is described here.)

Timeline for d1f8sa1: