Lineage for d2jfdd2 (2jfd D:617-680)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114468Fold c.19: FabD/lysophospholipase-like [52150] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 432156; strand 4 is antiparallel to the rest
  4. 2114469Superfamily c.19.1: FabD/lysophospholipase-like [52151] (3 families) (S)
  5. 2114470Family c.19.1.1: FabD-like [52152] (4 proteins)
    the superfamily common core covers almost all of the family fold
  6. 2114490Protein Ferredoxin-like domain from acyl transferase MAT [310772] (1 species)
  7. 2114491Species Human (Homo sapiens) [TaxId:9606] [311028] (1 PDB entry)
  8. 2114495Domain d2jfdd2: 2jfd D:617-680 [304126]
    Other proteins in same PDB: d2jfda1, d2jfda3, d2jfda4, d2jfda5, d2jfdb1, d2jfdb3, d2jfdb4, d2jfdb5, d2jfdc1, d2jfdc3, d2jfdc4, d2jfdc5, d2jfdd1, d2jfdd3, d2jfdd4, d2jfdd5

Details for d2jfdd2

PDB Entry: 2jfd (more details), 2.81 Å

PDB Description: structure of the mat domain of human fas
PDB Compounds: (D:) fatty acid synthase

SCOPe Domain Sequences for d2jfdd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jfdd2 c.19.1.1 (D:617-680) Ferredoxin-like domain from acyl transferase MAT {Human (Homo sapiens) [TaxId: 9606]}
pgamaavglsweeckqrcppgvvpachnskdtvtisgpqapvfefveqlrkegvfakevr
tggm

SCOPe Domain Coordinates for d2jfdd2:

Click to download the PDB-style file with coordinates for d2jfdd2.
(The format of our PDB-style files is described here.)

Timeline for d2jfdd2: