SCOPe 2.08: Domain d2j8eb_: 2j8e B:

Lineage for d2j8eb_ (2j8e B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein automated matches [190177] (9 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [186909] (5 PDB entries)

8. Domain d2j8eb_: 2j8e B: [304106]
   automated match to d3fgza_
   complexed with bef, gol, mn, nh4

Details for d2j8eb_

PDB Entry: 2j8e, 2 Å

PDB Description: chey-phob emr chimera to study dephosphorylation of response regulators

PDB Compounds: (B:) Chemotaxis protein cheY

SCOPe Domain Sequences for d2j8eb_:

Sequence; same for both SEQRES and ATOM records:

>d2j8eb_ c.23.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
adkelkflvvddestmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwmmp
nmdglellktiradgamsalpvlmvtarakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm

Timeline for d2j8eb_:

• d2j8eb_ first appeared in SCOPe 2.06
  
• d2j8eb_ appears in SCOPe 2.07