Lineage for d2j8ea_ (2j8e A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855425Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2855710Protein automated matches [190177] (9 species)
    not a true protein
  7. 2855749Species Escherichia coli [TaxId:562] [186909] (5 PDB entries)
  8. 2855757Domain d2j8ea_: 2j8e A: [304105]
    automated match to d3fgza_
    complexed with bef, gol, mn, nh4

Details for d2j8ea_

PDB Entry: 2j8e (more details), 2 Å

PDB Description: chey-phob emr chimera to study dephosphorylation of response regulators
PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d2j8ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j8ea_ c.23.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
adkelkflvvddestmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwmmp
nmdglellktiradgamsalpvlmvtarakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm

SCOPe Domain Coordinates for d2j8ea_:

Click to download the PDB-style file with coordinates for d2j8ea_.
(The format of our PDB-style files is described here.)

Timeline for d2j8ea_: