Lineage for d2j2th_ (2j2t H:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2213803Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2213804Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2213889Family d.126.1.6: Porphyromonas-type peptidylarginine deiminase [111155] (3 proteins)
    Pfam PF04371; functionally related to the amidinotransferase, similar active site
  6. 2213913Protein automated matches [190353] (2 species)
    not a true protein
  7. 2213914Species Enterococcus faecalis [311217] (1 PDB entry)
  8. 2213922Domain d2j2th_: 2j2t H: [304101]
    automated match to d2jerd_

Details for d2j2th_

PDB Entry: 2j2t (more details), 1.65 Å

PDB Description: agmatine deiminase from enterococcus faecalis covalently linked with a reaction intermediate
PDB Compounds: (H:) agmatine deiminase

SCOPe Domain Sequences for d2j2th_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j2th_ d.126.1.6 (H:) automated matches {Enterococcus faecalis}
akrivgstpkqdgfrmpgefepqekvwmiwperpdnwrdggkpvqeaftnvakaisqftp
mnvvvsqqqfqncrrqlppeitvyemsnndawvrdcgpsfvindhgeirgvdwtfnawgg
lvdglyfpwdqddlvaqkiceiehvdsyrtddfvleggsfhvdgqgtvlttemcllsegr
npqlskeaieqklcdylnvekvlwlgdgidpeetnghvddvacfiapgevaciytedqns
pfyeaaqdayqrllkmtdakgrqlkvhklccpvknvtikgsfkidfvegtmpredgdici
asymnflitndgvivpqygdendhlaleqvqtmfpdkkivgvntvevvygggnihxitqq
epkrv

SCOPe Domain Coordinates for d2j2th_:

Click to download the PDB-style file with coordinates for d2j2th_.
(The format of our PDB-style files is described here.)

Timeline for d2j2th_: