SCOPe 2.08: Domain d2j2th_: 2j2t H:

Lineage for d2j2th_ (2j2t H:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
   duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis

4. Superfamily d.126.1: Pentein [55909] (8 families)

5. Family d.126.1.6: Porphyromonas-type peptidylarginine deiminase [111155] (3 proteins)
   Pfam PF04371; functionally related to the amidinotransferase, similar active site

6. Protein automated matches [190353] (3 species)
   not a true protein

7. Species Enterococcus faecalis [311217] (1 PDB entry)

8. Domain d2j2th_: 2j2t H: [304101]
   Other proteins in same PDB: d2j2td2
   automated match to d2jerd_

Details for d2j2th_

PDB Entry: 2j2t, 1.65 Å

PDB Description: agmatine deiminase from enterococcus faecalis covalently linked with a reaction intermediate

PDB Compounds: (H:) agmatine deiminase

SCOPe Domain Sequences for d2j2th_:

Sequence; same for both SEQRES and ATOM records:

>d2j2th_ d.126.1.6 (H:) automated matches {Enterococcus faecalis}
akrivgstpkqdgfrmpgefepqekvwmiwperpdnwrdggkpvqeaftnvakaisqftp
mnvvvsqqqfqncrrqlppeitvyemsnndawvrdcgpsfvindhgeirgvdwtfnawgg
lvdglyfpwdqddlvaqkiceiehvdsyrtddfvleggsfhvdgqgtvlttemcllsegr
npqlskeaieqklcdylnvekvlwlgdgidpeetnghvddvacfiapgevaciytedqns
pfyeaaqdayqrllkmtdakgrqlkvhklccpvknvtikgsfkidfvegtmpredgdici
asymnflitndgvivpqygdendhlaleqvqtmfpdkkivgvntvevvygggnihcitqq
epkrv

Timeline for d2j2th_:

• d2j2th_ first appeared in SCOPe 2.06
  
• d2j2th_ appears in SCOPe 2.07